CCDC7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56757

Product Code. 18279762

Description

CCDC7 Polyclonal specifically detects CCDC7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCDC7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BioT2-A, BioT2-B, BioT2-C, coiled-coil domain containing 7, coiled-coil domain-containing protein 7, DKFZp686N0559, FLJ32762, RP11-479G22.1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 221016
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96M83
• Gene Symbols: CCDC7
• Immunogen: Synthetic peptides corresponding to CCDC7(coiled-coil domain containing 7) The peptide sequence was selected from the N terminal of CCDC7. Peptide sequence KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Rat: 92%; Bovine: 85%; Mouse: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Rabbit
• Isotype: IgG