missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC46 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CCDC46 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCDC46 Polyclonal specifically detects CCDC46 in Human samples. It is validated for Western Blot.Specifications
| CCDC46 | |
| Polyclonal | |
| Rabbit | |
| NP_001032402 | |
| 201134 | |
| Synthetic peptide directed towards the C terminal of human CCDC46The immunogen for this antibody is CCDC46. Peptide sequence IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| coiled-coil domain containing 46, coiled-coil domain-containing protein 46, FLJ39610, MGC33887 | |
| CEP112 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title