CCDC24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18441132	Novus Biologicals NBP2-34179-25ul	25 μL
18176232	Novus Biologicals NBP2-34179	0.1 mL

Descrizione

CCDC24 Polyclonal specifically detects CCDC24 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifica

• Antigen: CCDC24
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Coiled-Coil Domain Containing 24, Coiled-Coil Domain-Containing Protein 24, RP5-1198O20.2
• Gene Symbols: CCDC24
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q8N4L8
• Gene ID (Entrez): 149473
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLWELVEEHVPLRERREVKRILGEAAVDLSLELRAEVAMLRALLQEARSSQAPSSRPISDPSSLLAP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only