missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC146 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CCDC146 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCDC146 Polyclonal specifically detects CCDC146 in Human samples. It is validated for Western Blot.Specifications
| CCDC146 | |
| Polyclonal | |
| Rabbit | |
| Q8IYE0 | |
| 57639 | |
| Synthetic peptides corresponding to CCDC146 (coiled-coil domain containing 146) The peptide sequence was selected from the middle region of CCDC146. Peptide sequence KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| coiled-coil domain containing 146, KIAA1505coiled-coil domain-containing protein 146 | |
| CCDC146 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title