missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC138 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CCDC138 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCDC138 Polyclonal specifically detects CCDC138 in Human samples. It is validated for Western Blot.Specifications
| CCDC138 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| coiled-coil domain containing 138, coiled-coil domain-containing protein 138, FLJ32745 | |
| CCDC138 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96M89 | |
| 165055 | |
| Synthetic peptides corresponding to CCDC138(coiled-coil domain containing 138) The peptide sequence was selected from the N terminal of CCDC138. Peptide sequence EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title