missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC110 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CCDC110 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCDC110 Polyclonal specifically detects CCDC110 in Human samples. It is validated for Western Blot.Specifications
| CCDC110 | |
| Polyclonal | |
| Rabbit | |
| NP_689988 | |
| 256309 | |
| Synthetic peptide directed towards the middle region of human CCDC110The immunogen for this antibody is CCDC110. Peptide sequence KEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Cancer/testis antigen 52, coiled-coil domain containing 110, coiled-coil domain-containing protein 110, CT52Cancer/testis antigen KM-HN-1, KMHN1KM-HN-1, MGC33607 | |
| CCDC110 | |
| IgG | |
| 97 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title