CCDC110 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79593

Product Code. 18210826

Description

CCDC110 Polyclonal specifically detects CCDC110 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCDC110
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cancer/testis antigen 52, coiled-coil domain containing 110, coiled-coil domain-containing protein 110, CT52Cancer/testis antigen KM-HN-1, KMHN1KM-HN-1, MGC33607
• Host Species: Rabbit
• Molecular Weight of Antigen: 97 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_689988
• Gene Symbols: CCDC110
• Immunogen: Synthetic peptide directed towards the middle region of human CCDC110The immunogen for this antibody is CCDC110. Peptide sequence KEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 256309
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.