missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC102B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | CCDC102B |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18184469
|
Novus Biologicals
NBP2-38575 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18696485
|
Novus Biologicals
NBP2-38575-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CCDC102B Polyclonal specifically detects CCDC102B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CCDC102B | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ACY1L, aminoacylase 1-like, AN, C18orf14, chromosome 18 open reading frame 14, coiled-coil domain containing 102B, coiled-coil domain-containing protein 102B, DKFZp434K1426, DKFZp686I08254, FLJ23594, HsT1731, MGC161726, MGC161728 | |
| CCDC102B | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q68D86 | |
| 79839 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MNLDSIHRLIEETQIFQMQQSSIKSRGDMVAPASPPRDTCNTCFPLHGLQSHAAHNFCAHSYNTNKWDICEELRLRE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title