CCBL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-87387

Product Code. 18209846

Description

CCBL2 Polyclonal specifically detects CCBL2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CCBL2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: cysteine conjugate-beta lyase 2, Cysteine-S-conjugate beta-lyase 2, DKFZp547N1117, EC 2.6.1.63, EC 2.6.1.7, EC 4.4.1.13, KAT3DKFZp667D0223, KATIII, Kynurenine aminotransferase III, Kynurenine--glyoxylate transaminase, kynurenine-oxoglutarate transaminase 3, kynurenine--oxoglutarate transaminase 3, Kynurenine--oxoglutarate transaminase III, MGC9398, RBM1, RP11-82K18.3, RP4-531M19.2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56267
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CCBL2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only