missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBX6 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £358.00
Specifications
| Antigen | CBX6 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
CBX6 Polyclonal antibody specifically detects CBX6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CBX6 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Chromatin Modifiers | |
| PBS with 50% glycerol, pH7.3. | |
| 23466 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| chromobox homolog 6, chromobox protein homolog 6 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human CBX6 (NP_055107.3). LLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title