missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBX4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£435.00
Specifications
| Antigen | CBX4 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CBX4 Polyclonal specifically detects CBX4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CBX4 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8535 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDSGAEEK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| chromobox homolog 4, chromobox homolog 4 (Drosophila Pc class), Chromobox protein homolog 4, Drosophila), E3 SUMO-protein ligase CBX4, hPC2, NS5ATP1-binding protein 16, Pc class 2 homolog, PC2, Polycomb 2 homolog | |
| CBX4 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title