missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBR4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CBR4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CBR4 Polyclonal specifically detects CBR4 in Human samples. It is validated for Western Blot.Specifications
| CBR4 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| 3-oxoacyl-[acyl-carrier-protein] reductase, carbonic reductase 4, carbonyl reductase 4, carbonyl reductase family member 4, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.100, FLJ14431, Quinone reductase CBR4, SDR45C1, short chain dehydrogenase/reductase family 45C, member 1 | |
| CBR4 | |
| IgG | |
| 25 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_116172 | |
| 84869 | |
| Synthetic peptide directed towards the N terminal of human CBR4The immunogen for this antibody is CBR4. Peptide sequence RKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKH. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title