missing translation for 'onlineSavingsMsg'
Learn More

Cav3.2 Antibody, Novus Biologicals™

Product Code. 18400851 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18400851 25 μL 25µL
18484961 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18400851 Supplier Novus Biologicals Supplier No. NBP18817625ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Cav3.2 Polyclonal antibody specifically detects Cav3.2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cav3.2
Applications Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias CACNA1HB, calcium channel, voltage-dependent, T type, alpha 1H subunit, calcium channel, voltage-dependent, T type, alpha 1Hb subunit, Cav3.2, ECA6, EIG6, FLJ90484, Low-voltage-activated calcium channel alpha1 3.2 subunit, low-voltage-activated calcium channel alpha13.2 subunit, voltage dependent t-type calcium channel alpha-1H subunit, voltage-dependent T-type calcium channel subunit alpha-1H, voltage-gated calcium channel alpha subunit Cav3.2, voltage-gated calcium channel alpha subunit CavT.2, Voltage-gated calcium channel subunit alpha Cav3.2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 8912
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.