missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Cav2.2 Polyclonal antibody specifically detects Cav2.2 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | Cav2.2 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | BIII, Brain calcium channel III, CACNL1A5calcium channel, L type, alpha-1 polypeptide, CACNN, calcium channel alpha12.2 subunit, calcium channel, N type, calcium channel, voltage-dependent, alpha 1B subunit, N type, calcium channel, voltage-dependent, L type, alpha 1B subunit, calcium channel, voltage-dependent, N type, alpha 1B subunit, Cav2.2, Cav2.2 voltage-gated Ca2+ channel, L type, alpha-1 polypeptide isoform 5, voltage-dependent N-type calcium channel subunit alpha-1B, Voltage-gated calcium channel subunit alpha Cav2.2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?