CAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59857

Product Code. 18276643

Description

CAT1 Polyclonal specifically detects CAT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CAT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: amino acid transporter, cationic 1, ATRC1ERR, CAT-1System Y+ basic amino acid transporter, Ecotropic retroviral leukemia receptor homolog, ecotropic retroviral receptor, Ecotropic retrovirus receptor homolog, HCAT1, high affinity cationic amino acid transporter 1, REC1LCAT1, solute carrier family 7 (cationic amino acid transporter, y+ system), member 1, Solute carrier family 7 member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 68 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 92%; Pig: 85%.
• Target Species: Human, Pig, Bovine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P30825
• Gene Symbols: SLC7A1
• Immunogen: The immunogen for anti-SLC7A1 antibody: synthetic peptide directed towards the N terminal of human SLC7A1. Peptide sequence LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6541
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only