missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18372159

CAT1 Antibody (2B9), Novus Biologicals™

Product Code. 18372159 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18372159 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18372159 Supplier Novus Biologicals Supplier No. H00006541M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

CAT1 Monoclonal antibody specifically detects CAT1 in Human, Mouse samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen CAT1
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 2B9
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003036
Gene Alias amino acid transporter, cationic 1, ATRC1ERR, CAT-1System Y+ basic amino acid transporter, Ecotropic retroviral leukemia receptor homolog, ecotropic retroviral receptor, Ecotropic retrovirus receptor homolog, HCAT1, high affinity cationic amino acid transporter 1, REC1LCAT1, solute carrier family 7 (cationic amino acid transporter, y+ system), member 1, Solute carrier family 7 member 1
Host Species Mouse
Immunogen SLC7A1 (NP_003036, 431 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6541
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.