missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CASS4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10642-100UL
This item is not returnable.
View return policy
Description
CASS4 Polyclonal specifically detects CASS4 in Human samples. It is validated for Western Blot.
Specifications
| CASS4 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| C20orf32, Cas scaffolding protein family member 4, HEF1-EFS-p130Cas-like protein, HEFLchromosome 20 open reading frame 32, HEF-like protein, HEPLCAS4 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human CASS4. Peptide sequence ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 57091 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering