missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Caspase 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | Caspase 5 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18423482
|
Novus Biologicals
NBP1-87682-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18260458
|
Novus Biologicals
NBP1-87682 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Caspase 5 Polyclonal specifically detects Caspase 5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Caspase 5 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| P51878 | |
| 838 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids 8 - 86 of human Caspase-5: VEGVFIFLIEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Caspases | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CASP-5, caspase 5, apoptosis-related cysteine peptidase, caspase 5, apoptosis-related cysteine protease, caspase-5, EC 3.4.22, EC 3.4.22.58, ICE(rel)III, ICE(rel)-III, ICEREL-III, ICH3, ICH-3, MGC141966, Protease ICH-3, Protease TY, TY protease | |
| CASP5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title