Caspase-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35895-20ul

Product Code. 30227619

Description

Caspase-4 Polyclonal antibody specifically detects Caspase-4 in Human samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)

Specifications

• Antigen: Caspase-4
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: apoptotic cysteine protease Mih1/TX, CASP-4, caspase 4, apoptosis-related cysteine peptidase, caspase 4, apoptosis-related cysteine protease, caspase-4, EC 3.4.22, EC 3.4.22.57, ICE(rel)II, ICE(rel)-II, ICEREL-II, ICH2, ICH-2, Mih1/TX, Protease ICH-2, Protease TX, TX
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 81-270 of human Caspase-4 (NP_001216.1).,, Sequence:, SDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
• Quantity: 20 μL
• Research Discipline: Apoptosis, Cancer, Caspases
• Gene ID (Entrez): 837
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified