CASK Interacting Protein 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17474-100UL

Product Code. 18324792

Description

CASK Interacting Protein 1 Polyclonal antibody specifically detects CASK Interacting Protein 1 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: CASK Interacting Protein 1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: ANKS5A, caskin-1, CASKIN1, CASK-Interacting Protein 1, KIAA1306
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVKHKEAIGPGGEVVNRRRTLSGPVTGLLATARRGPGESADPGPFVEDGTGRQRPRGPSK
• Quantity: 100 μg
• Research Discipline: Neuroscience
• Gene ID (Entrez): 57524
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified