missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Casein Kinase 2 beta Rabbit anti-Human, Mouse, Rat, Clone: 9T5J10, Novus Biologicals™

Casein Kinase 2 beta Rabbit anti-Human, Mouse, Rat, Clone: 9T5J10, Novus Biologicals™

Product Code. 18374216 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18374216 100 μg 100µL
18073684 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18374216 Supplier Novus Biologicals Supplier No. NBP316264100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Casein Kinase 2 beta Monoclonal antibody specifically detects Casein Kinase 2 beta in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Casein Kinase 2 beta
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 9T5J10
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias casein kinase 2, beta polypeptide, Casein kinase II beta subunit, casein kinase II subunit beta, CK II beta, CK2B, CSK2B, G5A, MGC138222, MGC138224, phosvitin, Protein G5a
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (P67870). YQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 1460
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.