Casein Kinase 1 delta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-52975

Product Code. 18200705

Description

Casein Kinase 1 delta Polyclonal specifically detects Casein Kinase 1 delta in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Casein Kinase 1 delta
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: casein kinase 1, delta, casein kinase I isoform delta, CKId, CKI-delta, EC 2.7.11, EC 2.7.11.1, HCKID
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 1453
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P48730
• Gene Symbols: CSNK1D
• Immunogen: Synthetic peptides corresponding to CSNK1D(casein kinase 1, delta) The peptide sequence was selected from the middle region of CSNK1D. Peptide sequence NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only