missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CART1 Polyclonal specifically detects CART1 in Mouse samples. It is validated for Western Blot.
Spécification
Spécification
| Antigen | CART1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | ALX homeobox 1, CART-1, CART1ALX homeobox protein 1, Cartilage homeoprotein 1, cartilage paired-class homeoprotein 1, FND3 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_766141). Peptide sequence MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCV |
| Purification Method | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?