missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Carm1 Recombinant Protein Antigen

Code produit 18241141 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantity:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
18241141 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18241141 Fournisseur Novus Biologicals™ Code fournisseur NBP254924PEP

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Carm1. Source: E.coli Amino Acid Sequence: DVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQ The Carm1 Recombinant Protein Antigen is derived from E. coli. The Carm1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 10498
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name Carm1 Recombinant Protein Antigen
Content And Storage −20°C, avoid freeze-thaw cycles
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias coactivator-associated arginine methyltransferase 1EC 2.1.1.-, EC 2.1.1, histone-arginine methyltransferase CARM1, PRMT4EC 2.1.1.125, Protein arginine N-methyltransferase 4
Gene Symbol CARM1
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51427. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Afficher plus Afficher moins

For research use only.

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.