Novus Biologicals™ Carm1 Recombinant Protein Antigen

Code produit	Quantity	unitSize
18241141	100 μL	100µL

Code produit 18241141 Fournisseur Novus Biologicals™ Code fournisseur NBP254924PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Carm1. Source: E.coli Amino Acid Sequence: DVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQ The Carm1 Recombinant Protein Antigen is derived from E. coli. The Carm1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Spécification

• Gene ID (Entrez): 10498
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: Carm1 Recombinant Protein Antigen
• Content And Storage: −20°C, avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: coactivator-associated arginine methyltransferase 1EC 2.1.1.-, EC 2.1.1, histone-arginine methyltransferase CARM1, PRMT4EC 2.1.1.125, Protein arginine N-methyltransferase 4
• Gene Symbol: CARM1
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51427. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.