missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CARD10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55720
This item is not returnable.
View return policy
Description
CARD10 Polyclonal specifically detects CARD10 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| CARD10 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| CARD-containing MAGUK 3 protein, CARD-containing MAGUK protein 3, Carma 3, CARMA3BIMP1Bcl10 binding protein and activator of NFKB, caspase recruitment domain family, member 10, caspase recruitment domain-containing protein 10, MGC142219 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CARD10 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPF | |
| 100 μL | |
| Apoptosis | |
| 29775 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction