missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carboxypeptidase X1/CPXM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Carboxypeptidase X1/CPXM1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Carboxypeptidase X1/CPXM1 Polyclonal specifically detects Carboxypeptidase X1/CPXM1 in Human samples. It is validated for Western Blot.Specifications
| Carboxypeptidase X1/CPXM1 | |
| Polyclonal | |
| Rabbit | |
| Q96SM3 | |
| 56265 | |
| Synthetic peptides corresponding to CPXM1 (carboxypeptidase X (M14 family), member 1) The peptide sequence was selected from the middle region of CPXM1)(50ug). Peptide sequence MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| carboxypeptidase X (M14 family), carboxypeptidase X (M14 family), member 1, CPX-1, CPX1EC 3.4.17.-, CPXM, EC 3.4.17, EC 3.4.17.10, EC 3.4.17.3, Metallocarboxypeptidase CPX-1, probable carboxypeptidase X1 | |
| CPXM1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title