missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Carboxypeptidase A1/CPA1 Antibody (CL6607), Novus Biologicals™

Carboxypeptidase A1/CPA1 Antibody (CL6607), Novus Biologicals™

Product Code. p-200084441 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18646561 25 μL 25µL
18273969 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18646561 Supplier Novus Biologicals Supplier No. NBP27650725ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Carboxypeptidase A1/CPA1 Monoclonal specifically detects Carboxypeptidase A1/CPA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Carboxypeptidase A1/CPA1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL6607
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias carboxypeptidase A1, carboxypeptidase A1 (pancreatic), CPA, EC 3.4.17, EC 3.4.17.1
Gene Symbols CPA1
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET
Quantity 25 μL
Primary or Secondary Primary
Gene ID (Entrez) 1357
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.