missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carbonic Anhydrase IX/CA9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54743-25ul
This item is not returnable.
View return policy
Description
Carbonic Anhydrase IX/CA9 Polyclonal specifically detects Carbonic Anhydrase IX/CA9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Carbonic Anhydrase IX/CA9 | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CA9 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL | |
| 25 μL | |
| Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction, Vision | |
| 768 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction