Carbohydrate Sulfotransferase 3/CHST3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57128

Product Code. 18286382

Description

Carbohydrate Sulfotransferase 3/CHST3 Polyclonal specifically detects Carbohydrate Sulfotransferase 3/CHST3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Carbohydrate Sulfotransferase 3/CHST3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: C6ST-1, C6ST1HSD, C6STEC 2.8.2.17, carbohydrate (chondroitin 6) sulfotransferase 3, carbohydrate sulfotransferase 3, Chondroitin 6-O-sulfotransferase 1, Chondroitin 6-sulfotransferase, EC 2.8.2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0, GST-0
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CHST3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 9469
• Target Species: Human
• Isotype: IgG

For Research Use Only