Carbohydrate Sulfotransferase 15/CHST15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59012

Product Code. 18236473

Description

Carbohydrate Sulfotransferase 15/CHST15 Polyclonal specifically detects Carbohydrate Sulfotransferase 15/CHST15 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Carbohydrate Sulfotransferase 15/CHST15
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B cell RAG associated protein (GALNAC4S-6ST), B-cell RAG-associated gene protein, BRAGKIAA0598RP11-47G11.1, carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15, carbohydrate sulfotransferase 15, DKFZp781H1369, EC 2.8.2.33, GalNAc4S-6ST, GALNAC4S6ST, hBRAG, MGC34346, N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51363
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7LFX5
• Gene Symbols: CHST15
• Immunogen: Synthetic peptides corresponding to GALNAC4S-6ST(B cell RAG associated protein) The peptide sequence was selected from the middle region of GALNAC4S-6ST. Peptide sequence YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Rat: 100%; Mouse: 100%; Human: 100%; Bovine: 92%; Chicken: 78%; Green puffer: 78%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only