CAPZB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18476660	Novus Biologicals NBP1-85922-25ul	25 μL
18259487	Novus Biologicals NBP1-85922	0.1 mL

Description

CAPZB Polyclonal specifically detects CAPZB in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CAPZB
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 832
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Rat
• Gene Alias: Cap Z, CAPB, CAPPB, capping protein (actin filament) muscle Z-line, beta, CAPZ, CapZ beta, F-actin capping protein beta subunit, F-actin-capping protein subunit beta, MGC104401, MGC129749, MGC129750
• Gene Symbols: CAPZB
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human CAPZB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only