missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18371508

CAPZB Antibody (4H8), Novus Biologicals™

Product Code. 18371508 Shop All Bio Techne Products
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
0.1 mg
missing translation for 'unitSize'
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18371508 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
This item is not returnable. View return policy
Product Code. 18371508 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' H00000832M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

CAPZB Monoclonal antibody specifically detects CAPZB in Human, Bovine samples. It is validated for Western Blot, ELISA, Dot Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CAPZB
Applications Western Blot, ELISA, Dot Blot
Classification Monoclonal
Clone 4H8
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Dot Blot
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004921
Gene Alias Cap Z, CAPB, CAPPB, capping protein (actin filament) muscle Z-line, beta, CAPZ, CapZ beta, F-actin capping protein beta subunit, F-actin-capping protein subunit beta, MGC104401, MGC129749, MGC129750
Host Species Mouse
Immunogen CAPZB (NP_004921, 192 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 832
Target Species Human, Bovine
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.