missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CAPZA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56416
This item is not returnable.
View return policy
Description
CAPZA3 Polyclonal specifically detects CAPZA3 in Human samples. It is validated for Western Blot.
Specifications
| CAPZA3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CAPAA3, CAPPA3F-actin capping protein alpha-3 subunit, capping protein (actin filament) muscle Z-line, alpha 3, CapZ alpha-3, CP-alpha-3, F-actin-capping protein subunit alpha-3, Germ cell-specific protein 3, GSG3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 93661 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q96KX2 | |
| CAPZA3 | |
| Synthetic peptides corresponding to CAPZA3(capping protein (actin filament) muscle Z-line, alpha 3) The peptide sequence was selected from the N terminal of CAPZA3. Peptide sequence MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC. | |
| 100 μL | |
| Primary | |
| This product is specific to Subunit or Isoform: alpha-3. | |
| Human, Mouse, Rat, Canine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction