missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CAPC/ LRRC26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-70485
This item is not returnable.
View return policy
Description
CAPC / LRRC26 Polyclonal specifically detects CAPC / LRRC26 in Human samples. It is validated for Western Blot.
Specifications
| CAPC / LRRC26 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| LRRC26 | |
| Synthetic peptides corresponding to CAPC LRRC26, The peptide sequence was selected from the middle region CAPC LRRC26. Peptide sequence LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA. | |
| Affinity purified | |
| RUO | |
| 389816 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| CAPC, cytokeratin associated protein, leucine rich repeat containing 26 | |
| Rabbit | |
| 37 kDa | |
| 100 μL | |
| Primary | |
| Guinea pig 77%, Porcine 77%, Equine 83%. | |
| Human, Bovine, Canine, Equine, Guinea Pig | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction