missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18405531

CaMKK alpha Antibody, Novus Biologicals™

Product Code. 18405531 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18405531 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18405531 Supplier Novus Biologicals Supplier No. NBP188208

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CaMKK alpha Polyclonal antibody specifically detects CaMKK alpha in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen CaMKK alpha
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias calcium/calmodulin-dependent protein kinase kinase 1, calcium/calmodulin-dependent protein kinase kinase 1, alpha, Calcium/calmodulin-dependent protein kinase kinase alpha, CaM-kinase IV kinase, CaM-kinase kinase 1, CaM-kinase kinase alpha, CaM-KK 1, CaMKK alpha, CaM-KK alpha, CAMKK alpha protein, CAMKKACaMKK 1, DKFZp761M0423, EC 2.7.11, EC 2.7.11.17, MGC34095
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 84254
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.