CaMKI gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57828

Product Code. 18257372

Description

CaMKI gamma Polyclonal specifically detects CaMKI gamma in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CaMKI gamma
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: calcium/calmodulin-dependent protein kinase IG, calcium/calmodulin-dependent protein kinase type 1G, CaM kinase I gamma, CaM kinase IG, CaMKI gamma, CaM-KI gamma, caMKIG, CaMK-like CREB kinase III, CLICKIII, dJ272L16.1, EC 2.7.11, EC 2.7.11.17, VWS1CLICK III
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Chicken: 92%; Pig: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96NX5
• Gene Symbols: CAMK1G
• Immunogen: Synthetic peptides corresponding to CAMK1G(calcium/calmodulin-dependent protein kinase IG) The peptide sequence was selected from the middle region of CAMK1G. Peptide sequence KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA.
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 57172
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.