missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CaMKI gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | CaMKI gamma |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CaMKI gamma Polyclonal specifically detects CaMKI gamma in Human samples. It is validated for Western Blot.Specifications
| CaMKI gamma | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| calcium/calmodulin-dependent protein kinase IG, calcium/calmodulin-dependent protein kinase type 1G, CaM kinase I gamma, CaM kinase IG, CaMKI gamma, CaM-KI gamma, caMKIG, CaMK-like CREB kinase III, CLICKIII, dJ272L16.1, EC 2.7.11, EC 2.7.11.17, VWS1CLICK III | |
| CAMK1G | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96NX5 | |
| 57172 | |
| Synthetic peptides corresponding to CAMK1G(calcium/calmodulin-dependent protein kinase IG) Antibody(against the N terminal of CAMK1G. Peptide sequence SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title