missing translation for 'onlineSavingsMsg'
Learn More

Calpain S1 Antibody (3C4), Novus Biologicals™

Product Code. 18378447 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18378447 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18378447 Supplier Novus Biologicals Supplier No. H00000826M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Calpain S1 Monoclonal antibody specifically detects Calpain S1 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), Proximity Ligation Assay, ELISA, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen Calpain S1
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), Proximity Ligation Assay, Sandwich ELISA, KnockDown
Classification Monoclonal
Clone 3C4
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry 1:10 to 1:500, Immunocytochemistry/ Immunofluorescence 1:10 to 1:500, Immunohistochemistry-Paraffin 1:10 to 1:500, Proximity Ligation Assay, Sandwich ELISA 1:100 to 1:2000, Knockdown Validated
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH00592
Gene Alias Calcium-activated neutral proteinase small subunit, Calcium-dependent protease small subunit 1, calcium-dependent protease, small subunit, calpain 4, small subunit (30K), Calpain regulatory subunit, calpain small subunit 1, calpain, small polypeptide, CALPAIN4, CANP, CANPS, CAPN4, CDPS, CSS1, epididymis secretory sperm binding protein
Host Species Mouse
Immunogen Calpain S1 (AAH00592, 172 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 826
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.