Calpain S1 Antibody (3C4), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00000826-M01

Product Code. 18378447

Description

Calpain S1 Monoclonal antibody specifically detects Calpain S1 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), Proximity Ligation Assay, ELISA, KnockDown

Specifications

• Antigen: Calpain S1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: Calcium-activated neutral proteinase small subunit, Calcium-dependent protease small subunit 1, calcium-dependent protease, small subunit, calpain 4, small subunit (30K), Calpain regulatory subunit, calpain small subunit 1, calpain, small polypeptide, CALPAIN4, CANP, CANPS, CAPN4, CDPS, CSS1, epididymis secretory sperm binding protein
• Immunogen: Calpain S1 (AAH00592, 172 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
• Quantity: 0.1 mg
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 826
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG1 κ

• Applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), Proximity Ligation Assay, Sandwich ELISA, KnockDown
• Clone: 3C4
• Dilution: Western Blot 1:500, ELISA, Immunohistochemistry 1:10 to 1:500, Immunocytochemistry/ Immunofluorescence 1:10 to 1:500, Immunohistochemistry-Paraffin 1:10 to 1:500, Proximity Ligation Assay, Sandwich ELISA 1:100 to 1:2000, Knockdown Validated
• Gene Accession No.: AAH00592
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified