Calpain 13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56669-25ul

Artikelnummer. 18679907

Beskrivelse

Calpain 13 Polyclonal specifically detects Calpain 13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Tekniske data

• Antigen: Calpain 13
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Calcium-activated neutral proteinase 13, calpain 13, calpain-13, CANP 13, EC 3.4.22.-, FLJ23523
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 92291
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CAPN13
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DGEFWMSCQDFQQKFIAMFICSEIPITLDHGNTLHEGWSQIMFRKQVILGNTAGGPRNDAQFNFSVQEPMEGTNVVVCVTVAVTPSNLKAEDA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only