missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Calpain 1 Rabbit anti-Human, Mouse, Rat, Clone: 10E6O5, Novus Biologicals™

Calpain 1 Rabbit anti-Human, Mouse, Rat, Clone: 10E6O5, Novus Biologicals™

Product Code. 18060226 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18060226 20 μg 20µL
18373667 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18060226 Supplier Novus Biologicals Supplier No. NBP31668720UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Calpain 1 Monoclonal antibody specifically detects Calpain 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Calpain 1
Applications Western Blot, Immunofluorescence
Classification Monoclonal
Clone 10E6O5
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias Calcium-activated neutral proteinase 1, calpain 1, (mu/I) large subunit, Calpain mu-type, calpain, large polypeptide L1, calpain-1 catalytic subunit, Calpain-1 large subunit, CANP, CANP 1, CANPL1EC 3.4.22.52, Cell proliferation-inducing gene 30 protein, cell proliferation-inducing protein 30, EC 3.4.22, Micromolar-calpain, muCANPCANP1, muCL
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384). DGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNG
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 823
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.