missing translation for 'onlineSavingsMsg'
Learn More

Calcineurin A Antibody (2G8), Novus Biologicals™

Product Code. 18369578 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18369578 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18369578 Supplier Novus Biologicals Supplier No. H00005530M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Calcineurin A Monoclonal antibody specifically detects Calcineurin A in Human, Rat, Porcine samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Calcineurin A
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 2G8
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry 1:10 to 1:500, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin 1:10 to 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000935
Gene Alias calcineurin A alpha, Calmodulin-dependent calcineurin A subunit alpha isoform, CALN, CALNAcatalytic subunit, alpha isoform, CAM-PRP catalytic subunit, CNA, CNA1CALNA1, EC 3.1.3.16, PPP2BCCN1, protein phosphatase 2B, catalytic subunit, alpha isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform(calcineurin A alpha), protein phosphatase 3, catalytic subunit, alpha isozyme, serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
Host Species Mouse
Immunogen PPP3CA (NP_000935, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Adaptive Immunity, Immunology, Protein Phosphatase, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5530
Target Species Human, Rat, Pig
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.