missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cadherin-7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Cadherin-7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Cadherin-7 Polyclonal specifically detects Cadherin-7 in Human samples. It is validated for Western Blot.Specifications
| Cadherin-7 | |
| Polyclonal | |
| Rabbit | |
| Q9ULB5 | |
| 1005 | |
| Synthetic peptides corresponding to CDH7(cadherin 7, type 2) The peptide sequence was selected from the N terminal of CDH7. Peptide sequence PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cadherin 7, type 2, cadherin-7, CDH7L1 | |
| CDH7 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title