missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cadherin-20 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £359.00
Specifications
| Antigen | Cadherin-20 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18334254
|
Novus Biologicals
NBP3-10609-25UL |
25 μg |
£161.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18305585
|
Novus Biologicals
NBP3-10609-100UL |
100 μg |
£359.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cadherin-20 Polyclonal specifically detects Cadherin-20 in Rat samples. It is validated for Western Blot.Specifications
| Cadherin-20 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| cadherin 20, type 2, cadherin-20, CDH7L3Cdh7, FLJ37047 | |
| The immunogen is a synthetic peptide directed towards the middle region of Rat Cadherin-20 (NP_001012766). Peptide sequence DVTIGTTIQIISAKDPDMTNNSIRYSIDRGSDPGRFFYVDITTGALMTAR | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 28316 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title