missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cadherin-20 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10609-25UL
This item is not returnable.
View return policy
Beskrivning
Cadherin-20 Polyclonal specifically detects Cadherin-20 in Rat samples. It is validated for Western Blot.
Specifikationer
| Cadherin-20 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| cadherin 20, type 2, cadherin-20, CDH7L3Cdh7, FLJ37047 | |
| The immunogen is a synthetic peptide directed towards the middle region of Rat Cadherin-20 (NP_001012766). Peptide sequence DVTIGTTIQIISAKDPDMTNNSIRYSIDRGSDPGRFFYVDITTGALMTAR | |
| 25 μg | |
| Primary | |
| Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 28316 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering