CAD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58494-25ul

Code produit. 18697356

Description

CAD Polyclonal specifically detects CAD in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Spécification

• Antigen: CAD
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CAD protein, CAD trifunctional protein, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, anddihydroorotase, EC 2.1.3.2, EC 3.5.2.3, EC 6.3.5, EC 6.3.5.5, multifunctional protein CAD
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CAD
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVL
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Lipid and Metabolism
• Gene ID (Entrez): 790
• Target Species: Human
• Isotype: IgG

For Research Use Only