CACYBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18484491	Novus Biologicals NBP1-87104-25ul	25 μL
18290897	Novus Biologicals NBP1-87104	0.1 mL

Description

CACYBP Polyclonal specifically detects CACYBP in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CACYBP
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Accession No.: Q9HB71
• Gene ID (Entrez): 27101
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Wnt Signaling Pathway
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CacyBP, calcyclin binding protein, GIG5, hCacyBP, MGC87971, RP1-102G20.6, S100A6-binding protein, S100A6BPgrowth-inhibiting gene 5 protein, Siah-interacting protein, Siah-interacting protein (SIP), SIPcalcyclin-binding protein
• Gene Symbols: CACYBP
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only