CACNG4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-55176

Codice prodotto. 18286765

Descrizione

CACNG4 Polyclonal specifically detects CACNG4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifica

• Antigen: CACNG4
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: calcium channel, voltage-dependent, gamma subunit 4, MGC11138, MGC24983, neuronal voltage-gated calcium channel gamma-4 subunit, TARP gamma-4, transmembrane AMPAR regulatory protein gamma-4, voltage-dependent calcium channel gamma-4 subunit
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27092
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CACNG4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSV
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only