missing translation for 'onlineSavingsMsg'
Learn More

CACNB2 Antibody (6C1), Novus Biologicals™

Product Code. 18359797 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18359797 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18359797 Supplier Novus Biologicals Supplier No. H00000783M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

CACNB2 Monoclonal antibody specifically detects CACNB2 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen CACNB2
Applications Western Blot, ELISA
Classification Monoclonal
Clone 6C1
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_963890
Gene Alias CAB2, CACNLB2, Calcium channel voltage-dependent subunit beta 2, calcium channel, voltage-dependent, beta 2 subunit, CAVB2, FLJ23743, Lambert-Eaton myasthenic syndrome antigen B, myasthenic (Lambert-Eaton) syndrome antigen B, MYSB, voltage-dependent L-type calcium channel subunit beta-2
Host Species Mouse
Immunogen CACNB2 (NP_963890, 213 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 783
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.