missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18360651

CACNA1G Antibody, Novus Biologicals™

Product Code. 18360651 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18360651 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18360651 Supplier Novus Biologicals Supplier No. NBP180105100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CACNA1G Polyclonal specifically detects CACNA1G in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CACNA1G
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 2.5 μ/mL
Formulation PBS and 2% Sucrose with no preservative
Gene Accession No. O43497
Gene Alias calcium channel, voltage-dependent, T type, alpha 1G subunit, cav3.1c, KIAA1123, voltage-dependent calcium channel alpha 1G subunit, voltage-dependent T-type calcium channel subunit alpha-1G, voltage-dependent, alpha 1G subunit, voltage-dependent, T type, alpha-1G subunit
Gene Symbols CACNA1G
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human CACNA1G (NP_938202). Peptide sequence VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS.
Quantity 100 μL
Primary or Secondary Primary
Gene ID (Entrez) 8913
Reconstitution Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1 mg/mL. Vortex followed by Centrifuge again to pellet the solution. (20 μL size only)
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.