missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CAC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-76539-25ul
This item is not returnable.
View return policy
Description
CAC1 Polyclonal specifically detects CAC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| CAC1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| C10orf46, CDK2-associated, cullin domain 1, chromosome 10 open reading frame 46, cullin, FLJ40409, MGC33215 | |
| Rabbit | |
| 25 μL | |
| 143384 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| CACUL1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ASSTININTSTSKFLMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction